Region 1 |
Type: | Disordered |
Name: | insertion domain |
Location: | 91 - 158 |
Length: | 68 |
Region sequence: |
RITKKRYRLDHLLKEQPEEVLKRLYRAMEVEEENLHALVQAMMQAPERAGGAMTAAGVLD PASGEPGD |
Modification type: | |
PDB: | 1ATI:A, 1ATI:B, 1B76:A, 1B76:B |
Structural/functional type: | Relationship to function unknown |
Functional classes: | Molecular assembly
|
Functional subclasses: | Fatty acylation (myristolation and palmitoylation)
Protein-tRNA binding
|
Detection methods:
- X-ray crystallography (273 K; ammonium sulfate 0.4 mM; ATP 5 mM; MgCl2 2 mM)
|
References:
- Arnez JG, Dock-Bregeon AC, Moras D. "Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine." J Mol Biol. 1999; 286(5): 1449-59. PubMed: 10064708
- Logan DT, Mazauric MH, Kern D, Moras D. "Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus." Embo J. 1995; 14(17): 4156-67. PubMed: 7556056
|
Comments:The PDB chains 1B76 A and B have the disordered region spanning residues 96-158.
|