| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Map of ordered and disordered regions | |
![]() ![]() Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information. |
Region 1 | |
Type: | Disordered |
Name: | N-terminal |
Location: | 1 - 32 |
Length: | 32 |
Region sequence: | MFGRDPFDSLFERMFKEFFATPMTGTTMIQSS |
Modification type: | Monomeric Native |
PDB: | |
Structural/functional type: | |
Functional classes: | Chaperones |
Functional subclasses: | Protein-protein binding |
Detection methods:
| |
References:
| |
Comments: |
References | |
|
Comments | |
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
|