| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Map of ordered and disordered regions | |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information. |
Region 1 | |
Type: | Disordered |
Name: | N-terminal domain |
Location: | 1 - 155 |
Length: | 155 |
Region sequence: |
MPTPSAPSPQPKGFRRAVSEQDAKQAEAVTSPRFIGRRQSLIEDARKEREAAAAAAAAAV |
Modification type: | Mutant Native |
PDB: | |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | Substrate/ligand binding |
Detection methods:
| |
References:
| |
Comments: |
References | |
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
|