Region 1 |
Type: | Disordered - Molten Globule |
Name: | |
Location: | 1 - 155 |
Length: | 155 |
Region sequence: |
MAQFGGEKYGGRHTDEYGNPIQQGAGAHRGGGIMGGGQQAGQHGTTGVLGHGTAGQHGTT GGGLGHGTAGTGGALGGQHRRSGSSSSSSSSESDGEGGRRKKGMKDKMKEKLPGGHGTTT DQQQYGTAATHGQAQQHEKKGIMDKIKEKLPGGQH |
Modification type: | Native
|
PDB: | |
Structural/functional type: | Function arises via a molten globule to order transition |
Functional classes: | Molecular recognition effectors
|
Functional subclasses: | Substrate/ligand binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV
- Nuclear magnetic resonance (NMR) (283 K; D2O 50 uL; Dsp16 (protein) 11.6 mg; EDTA 1 mM; KCl 100 mM; phosphate (buffer) 10 mM; water 450 uL)
- Nuclear magnetic resonance (NMR) (308 K; D2O 50 uL; Dsp16 (protein) 11.6 mg; EDTA 1 mM; KCl 100 mM; phosphate (buffer) 10 mM; water 450 uL)
|
References:
- Lisse T, Bartels D, Kalbitzer HR, Jaenicke R. "The recombinant dehydrin-like desiccation stress protein from the resurrection plant Craterostigma plantagineum displays no defined three-dimensional structure in its native state." Biol Chem. 1996; 377(9): 555-61. PubMed: 9067253
- Piatkowski D Schneider K Salamini F Bartels D. "Characterization of five abscisic acid-responsive cDNA clones isolated from the desiccation-tolerant plant Craterostigma plantagineum and their relationship to other water-stress genes." Plant Physiol. 1990; 94: 1682-1688.
|
Comments:
|