Annotation for this protein is in progress - please check future releases for more complete information



DP00113: Synaptobrevin homolog 1FASTA viewXML view

General information
DisProt:DP00113
Name:Synaptobrevin homolog 1
Synonym(s):SNC1_YEAST
First appeared in release:Release 1.0 (08/01/2003)
UniProt:P31109
UniGene: 
SwissProt: SNC1_YEAST
TrEMBL:  
NCBI (GI): 401107
Source organism:Saccharomyces cerevisiae (Baker's yeast)
Sequence length:117
Percent disordered:79%
Homologues: 


Native sequence

        10         20         30         40         50         60
         |          |          |          |          |          |
MSSSTPFDPY ALSEHDEERP QNVQSKSRTA ELQAEIDDTV GIMRDNINKV AERGERLTSI - 60
EDKADNLAVS AQGFKRGANR VRKAMWYKDL KMKMCLALVI IILLVVIIVP IAVHFSR



Functional narrative    

Involved in mediating targeting and transport of secretory proteins; forms a complex with Snc2p and Sec9p.

Region 1: 1-93

Map of ordered and disordered regions







Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.


Region 1
Type:Disordered
Name: 
Location:1 - 93
Length:93
Region sequence:

MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI
EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMK

Modification type: Fragment
PDB:  
Structural/functional type:  
Functional classes:  
Functional subclasses:  
Detection methods:
 
References:
  1. Rice LM, Brennwald P, Brunger AT. "Formation of a yeast SNARE complex is accompanied by significant structural changes." FEBS Lett. 1997; 415(1): 49-55. PubMed: 9326367

Comments:
 



References

  1. Gerst JE, Rodgers L, Riggs M, Wigler M. "SNC1, a yeast homolog of the synaptic vesicle-associated membrane protein/synaptobrevin gene family: genetic interactions with the RAS and CAP genes." Proc Natl Acad Sci U S A. 1992; 89(10): 4338-42. PubMed: 1316605


If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us.


Disprot-footer
Contact us