Annotation for this protein is in progress - please check future releases for more complete information



DP00119: Basic salivary proline-rich protein 4FASTA viewXML view

General information
DisProt:DP00119
Name:Basic salivary proline-rich protein 4
Synonym(s):PRB4_HUMAN
Salivary proline-rich protein Po
Parotid o protein
Salivary proline-rich protein II-1
Protein N1 [cleavage product 1]
Glycosylated protein A [cleavage product 2]
Peptide P-D [cleavage product 3]
Proline-rich peptide IB-5
First appeared in release:Release 1.0 (08/01/2003)
UniProt:P10163
UniGene:Hs.528651
SwissProt: PRB4_HUMAN
TrEMBL:  
NCBI (GI): 158517854
Source organism:Homo sapiens (Human)
Sequence length:310
Percent disordered:95%
Homologues: 


Native sequence

        10         20         30         40         50         60
         |          |          |          |          |          |
MLLILLSVAL LALSSAESSS EDVSQEESLF LISGKPEGRR PQGGNQPQRP PPPPGKPQGP - 60
PPQGGNQSQG PPPPPGKPEG RPPQGGNQSQ GPPPHPGKPE RPPPQGGNQS QGPPPHPGKP - 120
ESRPPQGGHQ SQGPPPTPGK PEGPPPQGGN QSQGTPPPPG KPEGRPPQGG NQSQGPPPHP - 180
GKPERPPPQG GNQSHRPPPP PGKPERPPPQ GGNQSQGPPP HPGKPEGPPP QEGNKSRSAR - 240
SPPGKPQGPP QQEGNKPQGP PPPGKPQGPP PPGGNPQQPQ APPAGKPQGP PPPPQGGRPP - 300
RPAQGQQPPQ

Region 1: 17-310

Map of ordered and disordered regions







Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.


Region 1
Type:Disordered
Name: 
Location:17 - 310
Length:294
Region sequence:

ESSSEDVSQEESLFLISGKPQGRRPQGGNQPQRPPPPPGKPQGPPPQGGNQSQGPPPPPG
KPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQSQGPPPHPGKPESRPPQGGHQSQGPPP
TPGKPEGPPPQGGNQSQGTPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQSHR
PPPPPGKPERPPPQGGNQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQEGNK
PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPPPPQGGRPPRPAQGQQPPQ

Modification type:  
PDB:  
Structural/functional type:  
Functional classes:  
Functional subclasses:  
Detection methods:
 
References:
  1. Loomis RE, Bergey EJ, Levine MJ, Tabak LA. "Circular dichroism and fluorescence spectroscopic analyses of a proline-rich glycoprotein from human parotid saliva." Int J Pept Protein Res. 1985; 26(6): 621-9. PubMed: 4093242

  2. Loomis RE, Tseng Ching-Chung, Levine MJ. "Dynamics of a proline-rich glycoprotein from human parotid saliva: a 360-MHz proton nuclear magnetic resonance investigation." Int J Biol Macromol. 1986; 8: 149-52.

Comments:
 



References

  1. Maeda N, Kim HS, Azen EA, Smithies O. "Differential RNA splicing and post-translational cleavages in the human salivary proline-rich protein gene system." J Biol Chem. 1985; 260(20): 11123-30. PubMed: 2993301



Comments


Disordered residues are found within the regions corresponding to cleavage products 1 - 3, however, these products are not discussed in the references provided.


If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us.


Disprot-footer
Contact us