Annotations for this protein have been verified by the authors of the corresponding papers



DP00200: T-cell surface glycoprotein CD3 zeta chain [Isoform 1]FASTA viewXML view

General information
DisProt:DP00200
Name:T-cell surface glycoprotein CD3 zeta chain [Isoform 1]
Synonym(s):CD3Z_HUMAN
T-cell receptor T3 zeta chain
CD-3-zeta
First appeared in release:Release 3.0 (02/17/2006)
UniProt:P20963-1
UniGene:Hs.156445
SwissProt: CD3Z_HUMAN
TrEMBL:  
NCBI (GI): 23830999
Source organism:Homo sapiens (Human)
Sequence length:164
Percent disordered:69%
Homologues: 


Native sequence

        10         20         30         40         50         60
         |          |          |          |          |          |
MKWKALFTAA ILQAQLPITE AQSFGLLDPK LCYLLDGILF IYGVILTALF LRVKFSRSAD - 60
APAYQQGQNQ LYNELNLGRR EEYDVLDKRR GRDPEMGGKP QRRKNPQEGL YNELQKDKMA - 120
EAYSEIGMKG ERRRGKGHDG LYQGLSTATK DTYDALHMQA LPPR



Functional narrative    

T cell receptor (TCR) complex is a member of the family of antigen receptors named multichain immune recognition receptors (MIRR). “It has been suggested that MIRR employ similar downstream signal transduction mechanisms involving members of the src family of protein tyrosine kinases, which are activated by antigen-receptor interaction and which couple antigen binding to downstream signal transduction processes. The TCR has an additional component, the zeta homodimer. Each zeta subunit has a small extracellular region (9 residues) carrying the intersubunit disulfide bond, a single transmembrane span per subunit, and a large, apparently unstructured cytoplasmic domain of ~110 residues… Among the TCR-associated chains, zeta is particularly interesting due to the presence of three ITAMs in its cytoplasmic tail, allowing for multiple phosphorylation states. In general, phosphorylation of both tyrosines within an ITAM is thought to be essential for signaling, as this is required for efficient recruitment of the tandem SH2 domain containing protein kinases Syk and ZAP-70 to the receptor complex. The syk-family kinases are activated by binding to phosphorylated ITAM domains carried on the receptor domains, and their activation results in recruitment of adapter and effector proteins such as LAT, SLP-76, and PKC, which couple receptor engagement to downstream signaling pathways, leading eventually to activation of transcription factors such as NF-kappaB, NF-AT, and AP-1. The mechanism of transmembrane signal transduction by these receptors is poorly understood.” (Sigalov et. al. 2004).

Region 1: 52-164

Map of ordered and disordered regions







Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.


Region 1
Type:Disordered
Name:cytoplasmic domain
Location:52 - 164
Length:113
Region sequence:

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLY
NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Modification type: Fragment
Native
PDB:  
Structural/functional type: Function arises from the disordered state
Functional classes: Molecular recognition effectors
Molecular assembly
Functional subclasses: Polymerization
Phosphorylation
Protein-protein binding
Detection methods:
  1. Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 7; 0.01 and 1.0 mM protein in PBS; 1.0 and 0.01 mm path-length)

  2. Nuclear magnetic resonance (NMR) (293 K; pH: 6.2; 0.9 mM protein in 20 mM sodium phosphate buffer; 600 MHz)

References:
  1. Sigalov A, Aivazian D, Stern L. "Homooligomerization of the cytoplasmic domain of the T cell receptor zeta chain and of other proteins containing the immunoreceptor tyrosine-based activation motif." Biochemistry. 2004; 43(7): 2049-61. PubMed: 14967045

Comments:
 



References

  1. Aivazian D, Stern LJ. "Phosphorylation of T cell receptor zeta is regulated by a lipid dependent folding transition." Nat Struct Biol. 2000; 7(11): 1023-6. PubMed: 11062556

  2. Baniyash M. "TCR zeta-chain downregulation: curtailing an excessive inflammatory immune response." Nat Rev Immunol. 2004; 4(9): 675-87. PubMed: 15343367

  3. Weissenhorn W, Eck MJ, Harrison SC, Wiley DC. "Phosphorylated T cell receptor zeta-chain and ZAP70 tandem SH2 domains form a 1:3 complex in vitro." Eur J Biochem. 1996; 238(2): 440-5. PubMed: 8681956


If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us.


Disprot-footer
Contact us