General information | DisProt: | DP00201 | Name: | ATP synthase-coupling factor 6, mitochondrial | Synonym(s): | ATP5J_BOVIN
ATPase subunit F6
| First appeared in release: | Release 2.1 (03/14/2005) | UniProt: | P02721 | UniGene: | Bt.404 | SwissProt: | ATP5J_BOVIN | TrEMBL: | | NCBI (GI): | 114687 | Source organism: | Bos taurus (Bovine) | Sequence length: | 108 | Percent disordered: | 70% | Homologues: | |
Native sequence |
10 20 30 40 50 60 | | | | | | MILQRLFRLS SAVQSAISVS WRRNIGITAV AFNKELDPVQ KLFVDKIREY RTKRQTSGGP - 60 VDAGPEYQQD LDRELFKLKQ MYGKADMNTF PNFTFEDPKF EVVEKPQS
|
Functional narrative |
The F6 subunit is one of the nonenzymatic components (CF(0) subunit) of the mitochondrial ATPase complex. F6 seems to be part of the stalk that links CF(0) to CF(1). F6 is also involved in the restoration of oligomycin-sensitive ATPase activity to depleted F1-F0 complexes.
|
Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
Region 1 | Type: | Disordered - Extended | Name: | ATP synthase coupling factor 6 | Location: | 33 - 108 | Length: | 76 | Region sequence: |
NKELDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPN FTFEDPKFEVVEKPQS | Modification type: | Native
| PDB: | 1VZS:A | Structural/functional type: | Relationship to function unknown | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Nuclear magnetic resonance (NMR) (300 K; pH: 6.5; sodium chloride 50 mM; sodium phosphate 20 mM)
| References:
- Carbajo RJ, Silvester JA, Runswick MJ, Walker JE, Neuhaus D. "Solution structure of subunit F(6) from the peripheral stalk region of ATP synthase from bovine heart mitochondria." J Mol Biol. 2004; 342(2): 593-603. PubMed: 15327958
| Comments:The SwissProt sequence includes a signal sequence that spans from residue 1 to 32 and was not included in the experimental sequence.
|
Region 2 | Type: | Disordered | Name: | | Location: | 56 - 66 | Length: | 11 | Region sequence: |
TSGGPVDAGPE | Modification type: | Native
| PDB: | | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- Nuclear magnetic resonance (NMR) (300 K; pH: 6.5; sodium chloride 50 mM; sodium phosphate 20 mM)
| References:
- Carbajo RJ, Silvester JA, Runswick MJ, Walker JE, Neuhaus D. "Solution structure of subunit F(6) from the peripheral stalk region of ATP synthase from bovine heart mitochondria." J Mol Biol. 2004; 342(2): 593-603. PubMed: 15327958
| Comments:The SwissProt sequence includes a signal sequence that spans from residue 1 to 32 and was not included in the experimental sequence.
|
Region 3 | Type: | Disordered | Name: | | Location: | 84 - 108 | Length: | 25 | Region sequence: |
KADMNTFPNFTFEDPKFEVVEKPQS | Modification type: | Native
| PDB: | | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- Nuclear magnetic resonance (NMR) (300 K; pH: 6.5; sodium chloride 50 mM; sodium phosphate 20 mM)
| References:
- Carbajo RJ, Silvester JA, Runswick MJ, Walker JE, Neuhaus D. "Solution structure of subunit F(6) from the peripheral stalk region of ATP synthase from bovine heart mitochondria." J Mol Biol. 2004; 342(2): 593-603. PubMed: 15327958
| Comments:The SwissProt sequence includes a signal sequence that spans from residue 1 to 32 and was not included in the experimental sequence.
|
Comments |
The ATP synthase is embedded in the inner membranes of mitochondria where it uses the proton motive force generated across the membrane by respiration to make ATP from ADP and inorganic phosphate. The enzyme has two major domains, a globular catalytic domain known as F1 that extends into the mitochondrial matrix, and a membrane domain known as Fo. The two domains are linked together by a central stalk and a peripheral stalk. The central stalk consists of subunits gamma, delta, and epsilon and its foot is intimately associated with a ring of c-subunits in the Fo domain. The peripheral stalk in bovine mitochondria consists of one copy of each of subunits OSCP, F6, b and d. F6 subunit was described first almost 40 years ago and shown to be required for restoration of ATP-Pi exchange and oligomycin-sensitive ATPase activity to F6-depleted ATP synthase.
Subunit F6 or coupling factor 6 is a 9 kDa (76 residues) acidic protein that is soluble and heat stable over a broad pH range. It is derived from the precursor protein (108 residues), deposited in Swiss-Prot as P02721 (ATPR_BOVIN).
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|