Region 1 |
Type: | Disordered |
Name: | peptide C |
Location: | 724 - 760 |
Length: | 37 |
Region sequence: |
EFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRP |
Modification type: | Fragment
Native
|
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | Molecular recognition effectors
|
Functional subclasses: | Protein-protein binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV
- Nuclear magnetic resonance (NMR)
- Analytical ultracentrifugation
|
References:
- Haarmann CS, Green D, Casarotto MG, Laver DR, Dulhunty AF. "The random-coil 'C' fragment of the dihydropyridine receptor II-III loop can activate or inhibit native skeletal ryanodine receptors." Biochem J. 2003; 372(Pt 2): 305-16. PubMed: 12620094
|
Comments:Peptide C is sufficient to activate the ryanodine receptor at physiological concentrations.
Structure determination experiments were conducted on isolated peptide C.
|