| Region 1 |
| Type: | Disordered |
| Name: | cytoplasmic domain |
| Location: | 1 - 50 |
| Length: | 50 |
| Region sequence: |
MAQWDDFPDQQEDTDSCTESVKFDARSVTALLPPHPKNGPTLQERMKSYK |
| Modification type: | Engineered
Fragment
|
| PDB: | |
| Structural/functional type: | |
| Functional classes: | |
| Functional subclasses: | Protein-protein binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (pH: 7; peptide (monomer or trimer (10 or 25 uM)); sodium phosphate 0.1 M)
|
References:
- Nakamura T, Hinagata J, Tanaka T, Imanishi T, Wada Y, Kodama T, Doi T. "HSP90, HSP70, and GAPDH directly interact with the cytoplasmic domain of macrophage scavenger receptors." Biochem Biophys Res Commun. 2002; 290(2): 858-64. PubMed: 11785981
|
Comments:The experimental sequence consisted of the first 50 residues of bovine MSR with a C17A substitution and a GC appended to the C-terminus. The C17A substitution has been shown to have no affect on the cell surface expression and endocytosis of MSR.
|
