Region 1 |
Type: | Disordered |
Name: | |
Location: | 103 - 158 |
Length: | 56 |
Region sequence: |
MFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMK |
Modification type: | |
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | |
Functional subclasses: | Metal binding
Protein-protein binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (298 K; )
- Circular dichroism (CD) spectroscopy, near-UV (298 K; )
|
References:
- McCubbin WD, Kay CM. "Trypsin digestion of bovine cardiac troponin C in the presence and absence of calcium." Can J Biochem Cell Biol. 1985; 63(8): 812-23. PubMed: 2933134
|
Comments:
|