Region 1 |
Type: | Disordered - Molten Globule |
Name: | |
Location: | 54 - 213 |
Length: | 160 |
Region sequence: |
MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYR GHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPE NYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
Modification type: | Native
|
PDB: | |
Structural/functional type: | Function arises from the molten globule state |
Functional classes: | Unknown
|
Functional subclasses: | Unknown
|
Detection methods:
- Circular dichroism (CD) spectroscopy, near-UV (298 K; pH: 8; NaCl (buffer) 200 mM; Tris-HCl (buffer) 50 mM)
- Dynamic light scattering
|
References:
- Sutovsky H, Gazit E. "The von Hippel-Lindau tumor suppressor protein is a molten globule under native conditions: implications for its physiological activities." J Biol Chem. 2004; 279(17): 17190-6. PubMed: 14963040
|
Comments:The physiological role of pVHL is not fully understood. However, it is suggested to play a role in protein degradation in the ubiquitin pathway and to be a regulator of multiple transcription pathways.
|