Region 1 |
Type: | Disordered - Molten Globule |
Name: | DREAM-C |
Location: | 65 - 256 |
Length: | 192 |
Region sequence: |
SELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQ GDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITK EEMLAIMKSIYDMMGRHTYPILREDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDEN IMNSMQLFENVI |
Modification type: | Fragment
Mutant
|
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | Molecular assembly
|
Functional subclasses: | Protein-DNA binding
Substrate/ligand binding
Protein-protein binding
|
Detection methods:
- Nuclear magnetic resonance (NMR) (305 K; [2H10]dithiothreitol 5 mM; [2H11]Tris (pH 7.4) 10 mM; EDTA 5 mM; H2O/2H2O (5%/95%) 0.3 ml; KCl 50 mM; protein (0.2 to 0.5 mM))
|
References:
- Osawa M, Dace A, Tong KI, Valiveti A, Ikura M, Ames JB. "Mg2+ and Ca2+ differentially regulate DNA binding and dimerization of DREAM." J Biol Chem. 2005; 280(18): 18008-14. PubMed: 15746104
|
Comments:DREAM-C is a mutant containing residues 65-256 of the full length protein, and contains the mutant residues D150N, E186Q, and E234Q.
|