Region 1 |
Type: | Disordered |
Name: | |
Location: | 1 - 116 |
Length: | 116 |
Region sequence: |
MKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRI KRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYKKSSSK |
Modification type: | Monomeric
Native
|
PDB: | |
Structural/functional type: | Function arises from the ordered state |
Functional classes: | Molecular assembly
|
Functional subclasses: | Protein-genomic RNA binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (310 K; )
- Circular dichroism (CD) spectroscopy, near-UV (310 K; )
- Nuclear magnetic resonance (NMR) (301 K; D20 (10%); Sodium cacodylate (pH 7.0) 10 mM; TMSP 20 ug/ml)
|
References:
- Henkels CH, Kurz JC, Fierke CA, Oas TG. "Linked folding and anion binding of the Bacillus subtilis ribonuclease P protein." Biochemistry. 2001; 40(9): 2777-89. PubMed: 11258888
- Henkels CH, Oas TG. "Thermodynamic Characterization of the Osmolyte- and Ligand-Folded States of Bacillus subtilis Ribonuclease P Protein." Biochemistry. 2005; 44(39): 13014-26. PubMed: 16185070
|
Comments:RNase P is predominantly unfolded when isolated from RNA and small molecule anions in a low-ionic strength buffer. The P protein can be induced to refold by increasing the anion concentration in solution or by the addition of the osmolyte trimethylamine N-oxide (TMAO).
|