| Region 1 |
| Type: | Disordered - Extended |
| Name: | N-terminal extension (Nte) |
| Location: | 1 - 71 |
| Length: | 71 |
| Region sequence: |
MAGPQRATSGLPTRRTTTRQPTRRAGSAIPERQTSTASPAVSTKTAAISRTRTLKSPGEP
ASVLAKRKERD |
| Modification type: | Fragment
Native
|
| PDB: | |
| Structural/functional type: | Function arises from the disordered state
|
| Functional classes: | Molecular recognition effectors
Molecular assembly
|
| Functional subclasses: | Flexible linkers/spacers
Protein-protein binding
|
Detection methods:
- Analytical ultracentrifugation (277 K; pH: 6.9; A25 buffer; KCl 25 mM; NaCl 200 mM; sucrose gradient (9-20%); TM-Nte (Nte fused to thioredoxin))
- Size exclusion/gel filtration chromatography
|
References:
- Stock MF, Chu J, Hackney DD. "The kinesin family member BimC contains a second microtubule binding region attached to the N terminus of the motor domain." J Biol Chem. 2003; 278(52): 52315-22. PubMed: 14530265
|
Comments:Stock, et al. (2003) found that the N-terminal extension (Nte) increased binding to the mictotubule (MT), ostensibly to "tether the motor domain to the MT while still allowing any conformational changes of the motor domain that are needed to produce rapid motitlity."
The N-terminal extension of BimC is present in A. nidulans, but generally not present in other members of the N-terminal motor proteins.
|
