General information | DisProt: | DP00011 | Name: | Sulfotransferase 1A3/1A4 | Synonym(s): | ST1A3_HUMAN
Monoamine-sulfating phenol sulfotransferase
Sulfotransferase, monoamine-preferring
Catecholamine-sulfating phenol sulfotransferase
HAST3
M-PST
Thermolabile phenol sulfotransferase
Placental estrogen sulfotransferase
TL-PST
EC=2.8.2.1
| First appeared in release: | Release 1.0 (08/01/2003) | UniProt: | P50224 | UniGene: | Hs.460558 | SwissProt: | ST1A3_HUMAN | TrEMBL: | | NCBI (GI): | 1711609 | Source organism: | Homo sapiens (Human) | Sequence length: | 295 | Percent disordered: | 24% | Homologues: | |
Native sequence |
10 20 30 40 50 60 | | | | | | MELIQDTSRP PLEYVKGVPL IKYFAEALGP LQSFQARPDD LLINTYPKSG TTWVSQILDM - 60 IYQGGDLEKC NRAPIYVRVP FLEVNDPGEP SGLETLKDTP PPRLIKSHLP LALLPQTLLD - 120 QKVKVVYVAR NPKDVAVSYY HFHRMEKAHP EPGTWDSFLE KFMAGEVSYG SWYQHVQEWW - 180 ELSRTHPVLY LFYEDMKENP KREIQKILEF VGRSLPEETM DFMVQHTSFK EMKKNPMTNY - 240 TTVPQELMDH SISPFMRKGM AGDWKTTFTV AQNERFDADY AEKMAGCSLS FRSEL
|
Functional narrative |
Catecholamine sulfotransferase is a member of the cytosolic sulfotransferase superfamily. Catecholamine sulfotransferase is primarily responsible for sulfonation of catecholamines which is regarded as a detoxification pathway and leads to the formation of readily excretable water soluble metabolites (Bidwell, 1999). Catecholamine sulfotransferase is located in the cytosol of the cell and interacts with adenosine 3’, 5’-diphosphate, sulfate, and dopamine, as well as other catecholamines. A shortage of catecholamine sulfotransferase may be linked to pseudopheochromocytoma. Many of the residues involved in cofactor and substrate binding are disordered or flexible in the catecholamine sulfotransferase (Bidwell, 1999).
|
Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
Region 1 | Type: | Disordered - Extended | Name: | | Location: | 216 - 261 | Length: | 46 | Region sequence: |
PEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMA | Modification type: | Fragment
| PDB: | 1CJM:A | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Metal sponge
| Functional subclasses: | Substrate/ligand binding
| Detection methods:
- X-ray crystallography (293 K; PAP at 277 K (pre-incubation for 1-2 hours); lithium sulfate 0.5 M; polyethylene glycol 8000 (5-7% (w/v)))
| References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 2 | Type: | Disordered | Name: | | Location: | 1 - 7 | Length: | 7 | Region sequence: |
MELIQDT | Modification type: | Fragment
| PDB: | 1CJM:A | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Unknown
| Functional subclasses: | Substrate/ligand binding
| Detection methods:
- X-ray crystallography (293 K; lithium sulfate 0.5 M; PAP at 277 K (pre-incubation for 1-2 hours); polyethylene glycol 8000 (5-7% (w/v)))
| References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 3 | Type: | Disordered | Name: | | Location: | 64 - 77 | Length: | 14 | Region sequence: |
GGDLEKCNRAPIYV | Modification type: | Fragment
| PDB: | 1CJM:A | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Unknown
| Functional subclasses: | Substrate/ligand binding
| Detection methods:
- X-ray crystallography (293 K; lithium sulfate 0.5 M; PAP at 277 K (pre-incubation for 1-2 hours); polyethylene glycol 8000 (5-7% (w/v)))
| References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 4 | Type: | Disordered | Name: | | Location: | 91 - 93 | Length: | 3 | Region sequence: |
SGL | Modification type: | Fragment
| PDB: | 1CJM:A | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Unknown
| Functional subclasses: | Substrate/ligand binding
| Detection methods:
- X-ray crystallography (293 K; lithium sulfate 0.5 M; PAP at 277 K (pre-incubation for 1-2 hours); polyethylene glycol 8000 (5-7% (w/v)))
| References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 5 | Type: | Disordered | Name: | | Location: | 294 - 295 | Length: | 2 | Region sequence: |
EL | Modification type: | Fragment
| PDB: | 1CJM:A | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Unknown
| Functional subclasses: | Substrate/ligand binding
| Detection methods:
- X-ray crystallography (293 K; lithium sulfate 0.5 M; PAP at 277 K (pre-incubation for 1-2 hours); polyethylene glycol 8000 (5-7% (w/v)))
| References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 7 | Type: | Ordered | Name: | | Location: | 8 - 63 | Length: | 56 | Region sequence: |
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQ | Modification type: | | PDB: | 1CJM:A | Structural/functional type: | | Functional classes: | | Functional subclasses: | | Detection methods: | References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 8 | Type: | Ordered | Name: | | Location: | 78 - 90 | Length: | 13 | Region sequence: |
RVPFLEVNDPGEP | Modification type: | | PDB: | 1CJM:A | Structural/functional type: | | Functional classes: | | Functional subclasses: | | Detection methods: | References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 9 | Type: | Ordered | Name: | | Location: | 94 - 215 | Length: | 122 | Region sequence: |
ETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPG TWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGR SL | Modification type: | | PDB: | 1CJM:A | Structural/functional type: | | Functional classes: | | Functional subclasses: | | Detection methods: | References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
Region 10 | Type: | Ordered | Name: | | Location: | 262 - 293 | Length: | 32 | Region sequence: |
GDWKTTFTVAQNERFDADYAEKMAGCSLSFRS | Modification type: | | PDB: | 1CJM:A | Structural/functional type: | | Functional classes: | | Functional subclasses: | | Detection methods: | References:
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
| Comments:
|
References |
- Bidwell LM, McManus ME, Gaedigk A, Kakuta Y, Negishi M, Pedersen L, Martin JL. "Crystal structure of human catecholamine sulfotransferase." J Mol Biol. 1999; 293(3): 521-30. PubMed: 10543947
- Dajani R, Cleasby A, Neu M, Wonacott AJ, Jhoti H, Hood AM, Modi S, Hersey A, Taskinen J, Cooke RM, Manchee GR, Coughtrie MW. "X-ray crystal structure of human dopamine sulfotransferase, SULT1A3. Molecular modeling and quantitative structure-activity relationship analysis demonstrate a molecular basis for sulfotransferase substrate specificity." J Biol Chem. 1999; 274(53): 37862-8. PubMed: 10608851
|
Comments |
Former DP00011 Region 6 (aa 216-224), was determined to be part of disordered Region 1 (aa 216-261) with no distinct separate disorder of its own, therefore it has been been 'decommissioned.'
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|