| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Map of ordered and disordered regions | |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information. |
Region 1 | |
Type: | Disordered |
Name: | |
Location: | 1 - 92 |
Length: | 92 |
Region sequence: |
MASQQEKKELDARARQGETVVPGGTGGKSLEAQQHLAEGRSKGGQTRKEQLGGEGYHEMG |
Modification type: | Native |
PDB: | |
Structural/functional type: | |
Functional classes: | Unknown |
Functional subclasses: | Unknown |
Detection methods:
| |
References:
| |
Comments: |
References | |
|
Comments | |
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
|