| General information | | DisProt: | DP00040 | | Name: | High mobility group protein HMG-I/HMG-Y | | Synonym(s): | HMGA1_HUMAN
HMG-I(Y)
High mobility group A non-histone chromosomal proteins
High mobility group AT-hook protein 1
High mobility group protein A1
High mobility group protein R
| | First appeared in release: | Release 1.0 (08/01/2003) | | UniProt: | P17096 | | UniGene: | Hs.518805 | | SwissProt: | HMGA1_HUMAN | | TrEMBL: | | | NCBI (GI): | 123377 | | Source organism: | Homo sapiens (Human) | | Sequence length: | 107 | | Percent disordered: | 100% | | Homologues: | |
| Native sequence |
10 20 30 40 50 60
| | | | | |
MSESSSKSSQ PLASKQEKDG TEKRGRGRPR KQPPVSPGTA LVGSQKEPSE VPTPKRPRGR - 60
PKGSKNKGAA KTRKTTTTPG RKPRGRPKKL EKEEEEGISQ ESSEEEQ
|
| Functional narrative |
HMGI/HMGY are nonhistone nuclear proteins that are thought to be involved in transcription by serving as architectural proteins and through interactions with different transcription factors. HMGI/(Y) binds to the minor groove of A+T rich regions in DNA. In free solution there is little, if any secondary structure but specific conformations are assumed upon binding to DNA. The protein levels are high during embryogenesis and low in normal adult tissue. Rearrangements of the HMGI(Y) genes play an important role in the generation of benign and malignant tumours of mesenchymal origin carrying a chromosomal translocation.
|
| Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
| Region 1 | | Type: | Disordered - Extended | | Name: | | | Location: | 1 - 107 | | Length: | 107 | | Region sequence: |
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ | | Modification type: | | | PDB: | 2EZD:A, 2EZE:A, 2EZF:A, 2EZG:A | | Structural/functional type: | Function arises from the disordered state
Function arises via a disorder to order transition
| | Functional classes: | Molecular assembly
| | Functional subclasses: | Protein-DNA binding
Protein-protein binding
| Detection methods:
- Nuclear magnetic resonance (NMR)
- Circular dichroism (CD) spectroscopy, far-UV
| References:
- Munshi N, Agalioti T, Lomvardas S, Merika M, Chen G, Thanos D. "Coordination of a transcriptional switch by HMGI(Y) acetylation." Science. 2001; 293(5532): 1133-1136. PubMed: 11498590
- Pierantoni GM, Fedele M, Pentimalli F, Benvenuto G, Pero R, Viglietto G, Santoro M, Chiariotti L, Fusco A. "High mobility group I (Y) proteins bind HIPK2, a serine-threonine kinase protein which inhibits cell growth." Oncogene. 2001; 20(43): 6132-6141. PubMed: 11593421
- Reeves, R.
Nissen, M. S. "Purification and assays for high mobility group HMG-I(Y) protein function." Methods of Enzymology. 1996; 304: 155-188. PubMed: 10372360
- Wang, D. Z.
Ray, P.
Boothby, M. "Interleukin 4-inducible phosphorylation of HMG-I(Y) is inhibited by rapamycin." J Biol Chem. 1995; 270(39): 22924-22932. PubMed: 7559428
| Comments:
|
| Comments |
Additional UniGene ID: Hs.703764
|
| If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|
