General information | DisProt: | DP00064 | Name: | Capsid protein | Synonym(s): | CAPSD_SBMV
Coat protein
SBMV coat protein
| First appeared in release: | Release 2.0 (02/14/2005) | UniProt: | P03607 | UniGene: | | SwissProt: | CAPSD_SBMV | TrEMBL: | | NCBI (GI): | 116795 | Source organism: | Southern bean mosaic virus (SBMV) | Sequence length: | 279 | Percent disordered: | 23% | Homologues: | |
Native sequence |
10 20 30 40 50 60 | | | | | | MSGLFHHRTK PREIRAFVMA TRLTKKQLAQ AIQNTLPNPP RRKRRAKRRA AQVPKPTQAG - 60 VSMAPIAQGT MVKLRPPMLR SSMDVTILSH CELSTELAVT VTIVVTSELV MPFTVGTWLR - 120 GVAQNWSKYA WVAIRYTYLP SCPTTTSGAI HMGFQYDMAD TLPVSVNQLS NLKGYVTGPV - 180 WEGQSGLCFV NNTKCPDTSR AITIALDTNE VSEKRYPFKT ATDYATAVGV NANIGNILVP - 240 ARLVTAMEGG SSKTAVNTGR LYASYTIRLI EPIAAALNL
|
Functional narrative |
This protein forms a protective coat around the viral RNA. This formation is common in many plant viruses. The coat is created by the combining of three different subgroups of the protein. Each subgroup is similar in composition, but differs slightly in conformation. The three groups join together in a symmetrical arrangement, forming a 60 sided coat containing the RNA inside. The amino ends of the proteins interact with the RNA and are believed to aid in docking the complex together.
|
Map of ordered and disordered regions |
![](regions/DP00064.gif)
![](regions/legend.gif)
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
Region 1 | Type: | Disordered | Name: | | Location: | 1 - 41 | Length: | 41 | Region sequence: |
ATRLTKKQLAQAIQNTLPNPPRRKRRAKRRAAQVPKPTQAG | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Hermodson MA, Abad-Zapatero C, Abdel-Meguid S, Pundak S, Rossmann MG, Tremaine J. "Amino acid sequence of southern bean mosaic virus coat protein and its relation to the three-dimensional structure of the virus." Virology. 1982; 119: 133-149.
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region is disordered in all three subunits.
|
Region 2 | Type: | Disordered | Name: | beta-annulus | Location: | 42 - 50 | Length: | 9 | Region sequence: |
VSMAPIAQG | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Protein-protein binding
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Hermodson MA, Abad-Zapatero C, Abdel-Meguid S, Pundak S, Rossmann MG, Tremaine J. "Amino acid sequence of southern bean mosaic virus coat protein and its relation to the three-dimensional structure of the virus." Virology. 1982; 119: 133-149.
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region is disordered in both the A and B subunits.
|
Region 3 | Type: | Disordered | Name: | beta-A | Location: | 51 - 64 | Length: | 14 | Region sequence: |
TMVKLRPPMLRSSM | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Hermodson MA, Abad-Zapatero C, Abdel-Meguid S, Pundak S, Rossmann MG, Tremaine J. "Amino acid sequence of southern bean mosaic virus coat protein and its relation to the three-dimensional structure of the virus." Virology. 1982; 119: 133-149.
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region is disordered in both the A and B subunits.
|
Region 4 | Type: | Disordered | Name: | | Location: | 1 - 38 | Length: | 38 | Region sequence: |
ATRLTKKQLAQAIQNTLPNPPRRKRRAKRRAAQVPKPT | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Rossmann MG, Abad-Zapatero C, Erickson JW, Savithri HS. "RNA-protein interactions in some small plant viruses." J Biomol Struct Dyn. 1983; 1(2): 565-79. PubMed: 6401119
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region corresponds to the C subunit only.
This region is part of the flexible arm that helps to determine binding specificity.
|
Region 5 | Type: | Disordered | Name: | | Location: | 1 - 62 | Length: | 62 | Region sequence: |
ATRLTKKQLAQAIQNTLPNPPRRKRRAKRRAAQVPKPTQAGVSMAPIAQGTMVKLRPPML RS | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Rossmann MG, Abad-Zapatero C, Erickson JW, Savithri HS. "RNA-protein interactions in some small plant viruses." J Biomol Struct Dyn. 1983; 1(2): 565-79. PubMed: 6401119
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region corresponds to the A subunit only.
|
Region 6 | Type: | Disordered | Name: | | Location: | 1 - 64 | Length: | 64 | Region sequence: |
ATRLTKKQLAQAIQNTLPNPPRRKRRAKRRAAQVPKPTQAGVSMAPIAQGTMVKLRPPML RSSM | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Relationship to function unknown | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Rossmann MG, Abad-Zapatero C, Erickson JW, Savithri HS. "RNA-protein interactions in some small plant viruses." J Biomol Struct Dyn. 1983; 1(2): 565-79. PubMed: 6401119
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region corresponds to the B subunit only.
|
Region 7 | Type: | Ordered | Name: | | Location: | 39 - 63 | Length: | 25 | Region sequence: |
QAGVSMAPIAQGTMVKLRPPMLRSS | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Function arises from the ordered state | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
- Silva AM, Rossmann MG. "Refined structure of southern bean mosaic virus at 2.9 A resolution." J Mol Biol. 1987; 197(1): 69-87. PubMed: 3681993
| Comments:This section is only ordered in the C subunit, and is important in stabilizing the capsid.
|
Region 8 | Type: | Ordered | Name: | beta-annulus | Location: | 42 - 50 | Length: | 9 | Region sequence: |
VSMAPIAQG | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Function arises from the ordered state | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- X-ray crystallography (ammonium sulfate 0.015 M)
| References:
- Hermodson MA, Abad-Zapatero C, Abdel-Meguid S, Pundak S, Rossmann MG, Tremaine J. "Amino acid sequence of southern bean mosaic virus coat protein and its relation to the three-dimensional structure of the virus." Virology. 1982; 119: 133-149.
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region is only ordered in the C subunit.
|
Region 9 | Type: | Ordered | Name: | beta A | Location: | 51 - 64 | Length: | 14 | Region sequence: |
TMVKLRPPMLRSSM | Modification type: | Fragment
| PDB: | 4SBV:A, 4SBV:B, 4SBV:C | Structural/functional type: | Function arises from the ordered state | Functional classes: | Unknown
| Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography ((NH4)2SO4 0.015 M)
| References:
- Hermodson MA, Abad-Zapatero C, Abdel-Meguid S, Pundak S, Rossmann MG, Tremaine J. "Amino acid sequence of southern bean mosaic virus coat protein and its relation to the three-dimensional structure of the virus." Virology. 1982; 119: 133-149.
- Rossmann MG, Abad-Zapatero C, Hermodson MA, Erickson JW. "Subunit interactions in southern bean mosaic virus." J Mol Biol. 1983; 166(1): 37-73. PubMed: 6854633
| Comments:This region is only ordered in the C subunit.
|
References |
- Abad-Zapatero C, Abdel-Meguid SS, Johnson JE, Leslie AG, Rayment I, Rossmann MG, Suck D, Tsukihara T. "Structure of southern bean mosaid virus at 2.8 A resolution." Nature. 1980; 286(5768): 33-9. PubMed: 19711553
- Hermodson MA, Abad-Zapatero C, Abdel-Meguid S, Pundak S, Rossmann MG, Tremaine J. "Amino acid sequence of southern bean mosaic virus coat protein and its relation to the three-dimensional structure of the virus." Virology. 1982; 119: 133-149.
|
Comments |
The Swiss-Prot entry for this protein has a 19 amino acid propeptide attachment on the N-terminal region. The coat protein follows immediately after is 260 amino acids long.
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|