Region 1 |
Type: | Disordered |
Name: | DNA binding domain |
Location: | 225 - 281 |
Length: | 57 |
Region sequence: |
SDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER |
Modification type: | Complex
Native
|
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | |
Functional subclasses: | Protein-DNA binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 7; KCl 200 mM; potassium phosphate 50 mM)
- Size exclusion/gel filtration chromatography
|
References:
- Weiss MA, Ellenberger T, Wobbe CR, Lee JP, Harrison SC, Struhl K. "Folding transition in the DNA-binding domain of GCN4 on specific binding to DNA." Nature. 1990; 347(6293): 575-8. PubMed: 2145515
|
Comments:
|