| General information | | DisProt: | DP00148_C004 | | Name: | Nucleocapsid protein p7 | | Synonym(s): | GAG_HV1B1
NC
Cleavage product 4 of Gag polyprotein [Isoform Gag polyprotein]
| | First appeared in release: | Release 3.0 (02/17/2006) | | UniProt: | P03347 | | UniGene: | | | SwissProt: | GAG_HV1B1 | | TrEMBL: | | | NCBI (GI): | 120827 | | Source organism: | Human immunodeficiency virus type 1 (isolate BH10 group M subtype B)(HIV-1) | | Sequence length: | 55 | | Percent disordered: | 100% | | Homologues: | |
| Native sequence |
10 20 30 40 50 60
| | | | | |
MQRGNFRNQR KMVKCFNCGK EGHTARNCRA PRKKGCWKCG KEGHQMKDCT ERQAN
|
| Functional narrative |
Nucleocapsid protein p7 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers. The nucleocapsid protein NCp7 of HIV-1 possesses nucleic acid chaperone properties that are critical for the two obligatory strand transfer reactions required for the synthesis of a complete proviral DNA by reverse transcriptase. The first DNA strand transfer relies on the destabilization by NCp7 of double-stranded segments of the transactivation response region (TAR) sequence at the 3' end of the genomic RNA and the complementary sequence cTAR at the 3' terminus of minus strong-stop DNA, the early product of reverse transcription. Nucleocapsid protein p7 is cleavage product 4 of Gag polyprotein [Isoform Gag polyprotein], encompassing a.a. 378-432 of the polyprotein.
|
| Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
| Region 1 | | Type: | Disordered - Extended | | Name: | | | Location: | 1 - 55 | | Length: | 55 | | Region sequence: |
MQRGNFRNQRKMVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN | | Modification type: | Native
| | PDB: | | | Structural/functional type: | Function arises from the disordered state
| | Functional classes: | Chaperones
| | Functional subclasses: | DNA unwinding
Protein-tRNA binding
| Detection methods:
- Nuclear magnetic resonance (NMR) (293 K; pH: 5.5; 100% D20; 5.0 mM protein; 600 MHz 'H frequency)
| References:
- Morellet N, Jullian N, De Rocquigny H, Maigret B, Darlix JL, Roques BP. "Determination of the structure of the nucleocapsid protein NCp7 from the human immunodeficiency virus type 1 by 1H NMR." 1992; 11(8): 3059-65. PubMed: 1639074
- Summers MF, Henderson LE, Chance MR, Bess JW Jr, South TL, Blake PR, Sagi I, Perez-Alvarado G, Sowder RC 3rd, Hare DR, et al. "Nucleocapsid zinc fingers detected in retroviruses: EXAFS studies of intact viruses and the solution-state structure of the nucleocapsid protein from HIV-1." 1992; 1(5): 563-74. PubMed: 1304355
| Comments:
|
| References |
- Azoulay J, Clamme JP, Darlix JL, Roques BP, Mély Y. "Destabilization of the HIV-1 complementary sequence of TAR by the nucleocapsid protein through activation of conformational fluctuations." J Mol Biol. 2003; 326(3): 691-700. PubMed: 12581633
|
| Comments |
Previous UniProt ID Q9PY17 was permanently deleted and there was no replacement entry for the protein. The entry DP00148 was modified to include full-length Gag polyprotein (not the same as DP00101, which is a different isolate), which includes the disordered region for nucleocapsid protein p7. A cleavage product entry (DP00148_C004) was added.
Previous entry DP00148 has been split into polyprotein (DP00148) and cleavage product
DP00148_C004. Disorder is characterized on the cleavage product.
|
| If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|
