Region 1 |
Type: | Disordered |
Name: | |
Location: | 39 - 185 |
Length: | 147 |
Region sequence: |
RPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYAS AQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQ PAQQAFQPAEPVAAPQPEPVAEPAPVM |
Modification type: | |
PDB: | |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods:
- Rotory shadowing electron microscopy (modeling as a worm-like chain)
|
References:
- Ohashi T, Hale CA, de Boer PA, Erickson HP. "Structural evidence that the P/Q domain of ZipA is an unstructured, flexible tether between the membrane and the C-terminal FtsZ-binding domain." J Bacteriol. 2002; 184(15): 4313-4315. PubMed: 12107152
|
Comments:The EM used in this study is a novel approach to demonstrate an unstructured protein. The unstructured protein is placed between two small globular domains and imaged by EM. Knowing the contour length, one can determine the persistance lengh from the average spacing of the two globular domains. A persistence length of 0.3-0.6 nm is characteristic of an unstructrured protein.
|