Region 1 |
Type: | Disordered |
Name: | |
Location: | 1 - 106 |
Length: | 106 |
Region sequence: |
MSTESALSYAALILADSEIEISSEKLLTLTNAANVPDENIWADIFAKALDGQNLKDLLVN FSAGAAAPAGVAGGVAGGEAGEAEAEKEEEEAKEESDDDMGFGLFD |
Modification type: | Native
|
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | Molecular recognition effectors
|
Functional subclasses: | Protein-protein binding
|
Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV
- Nuclear magnetic resonance (NMR)
- Fluorescence, intrinsic
- Stability at thermal extremes
- Sensitivity to proteolysis
|
References:
- Zurdo J, Gonzalez C, Sanz JM, Rico M, Remacha M, Ballesta JP. "Structural differences between Saccharomyces cerevisiae ribosomal stalk proteins P1 and P2 support their functional diversity." Biochemistry. 2000; 39(30): 8935-43. PubMed: 10913306
|
Comments:
|