| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Map of ordered and disordered regions | |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information. |
Region 1 | |
Type: | Disordered |
Name: | |
Location: | 1 - 10 |
Length: | 10 |
Region sequence: | MSDNDELQQI |
Modification type: | Complex Native |
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | Modification site |
Functional subclasses: | Protein-protein binding |
Detection methods:
| |
References:
| |
Comments:Disorder in this region is found in monomer A of the tetragonal unit cell. |
Region 2 | |
Type: | Disordered |
Name: | |
Location: | 1 - 16 |
Length: | 16 |
Region sequence: | MSDNDELQQIAHLRRE |
Modification type: | Complex Native |
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | Modification site |
Functional subclasses: | Protein-protein binding |
Detection methods:
| |
References:
| |
Comments:Disorder in this region is found in monomer B of the tetragonal unit cell. |
Region 3 | |
Type: | Disordered |
Name: | domain 2 |
Location: | 130 - 175 |
Length: | 46 |
Region sequence: | FHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLP |
Modification type: | Complex Native |
PDB: | |
Structural/functional type: | Function arises from the disordered state |
Functional classes: | Modification site |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments:Disorder in this region is found in monomer A of the tetragonal unit cell. |
Region 4 | |
Type: | Disordered |
Name: | domain 2 |
Location: | 128 - 175 |
Length: | 48 |
Region sequence: | KYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLP |
Modification type: | Complex Native |
PDB: | |
Structural/functional type: | Function arises from the disordered state |
Functional classes: | Modification site |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments:Disorder in this region is found in monomer B of the tetragonal unit cell. |
References | |
|
Comments | |
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
|