| Region 1 |
| Type: | Disordered |
| Name: | |
| Location: | 1 - 48 |
| Length: | 48 |
| Region sequence: |
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAF |
| Modification type: | Engineered
|
| PDB: | |
| Structural/functional type: | Relationship to function unknown
|
| Functional classes: | Modification site
|
| Functional subclasses: | Protein-protein binding
|
Detection methods:
- X-ray crystallography (100 K; Beta-mercaptoethanol 2.5 mM; NaCl 250 mM; polyethyleneimine (1.5%); potassium phosphate (pH 7.5) 50 mM; protein 7 mg/ml; Sodium citrate 20 mM)
|
References:
- Musayev FN, Di Salvo ML, Ko TP, Schirch V, Safo MK. "Structure and properties of recombinant human pyridoxine 5'-phosphate oxidase." Protein Sci. 2003; 12(7): 1455-63. PubMed: 12824491
|
Comments:
|
