| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Map of ordered and disordered regions | |
![]() ![]() Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information. |
Region 1 | |
Type: | Disordered |
Name: | |
Location: | 326 - 408 |
Length: | 83 |
Region sequence: |
LNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRA |
Modification type: | Fragment Native |
PDB: | |
Structural/functional type: | Relationship to function unknown |
Functional classes: | Unknown |
Functional subclasses: | Unknown |
Detection methods:
| |
References:
| |
Comments: |
Region 2 | |
Type: | Disordered |
Name: | |
Location: | 1 - 5 |
Length: | 5 |
Region sequence: | MAENG |
Modification type: | Engineered Fragment |
PDB: | 1YTY:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods: | |
References:
| |
Comments:This disordered protein entry is based solely on missing electron density in the Protein Data Bank. |
Region 3 | |
Type: | Disordered |
Name: | |
Location: | 190 - 194 |
Length: | 5 |
Region sequence: | AKKNE |
Modification type: | Engineered Fragment |
PDB: | 1YTY:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods: | |
References:
| |
Comments:This disordered protein entry is based solely on missing electron density in the Protein Data Bank. |
Region 4 | |
Type: | Disordered |
Name: | |
Location: | 225 - 230 |
Length: | 6 |
Region sequence: | SLEEKI |
Modification type: | Fragment |
PDB: | |
Structural/functional type: | Relationship to function unknown |
Functional classes: | Unknown |
Functional subclasses: | Unknown |
Detection methods:
| |
References:
| |
Comments: |
Region 5 | |
Type: | Disordered |
Name: | |
Location: | 1 - 8 |
Length: | 8 |
Region sequence: | MAENGDNE |
Modification type: | Native |
PDB: | |
Structural/functional type: | Function arises from the disordered state |
Functional classes: | Unknown |
Functional subclasses: | Unknown |
Detection methods:
| |
References:
| |
Comments: |
References | |
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
|