| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Map of ordered and disordered regions | |
![]() ![]() Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information. |
Region 1 | |
Type: | Disordered |
Name: | |
Location: | 158 - 158 |
Length: | 1 |
Region sequence: | R |
Modification type: | Fragment |
PDB: | 1XPA:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments: |
Region 2 | |
Type: | Disordered |
Name: | |
Location: | 168 - 179 |
Length: | 12 |
Region sequence: | KNPHHSQWGDMK |
Modification type: | Fragment |
PDB: | 1XPA:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments: |
Region 3 | |
Type: | Disordered |
Name: | |
Location: | 206 - 219 |
Length: | 14 |
Region sequence: | VRQENREKMKQKKF |
Modification type: | Fragment |
PDB: | 1XPA:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments: |
Region 4 | |
Type: | Ordered |
Name: | |
Location: | 10 - 157 |
Length: | 148 |
Region sequence: |
EAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKII |
Modification type: | |
PDB: | 1XPA:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments: |
Region 5 | |
Type: | Ordered |
Name: | |
Location: | 159 - 167 |
Length: | 9 |
Region sequence: | EPPLKFIVK |
Modification type: | |
PDB: | 1XPA:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments: |
Region 6 | |
Type: | Ordered |
Name: | |
Location: | 180 - 205 |
Length: | 26 |
Region sequence: | LYLKLQIVKRSLEVWGSQEALEEAKE |
Modification type: | |
PDB: | 1XPA:A |
Structural/functional type: | |
Functional classes: | |
Functional subclasses: | |
Detection methods:
| |
References:
| |
Comments: |
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
|