| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Map of ordered and disordered regions | |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information. |
Region 1 | |
Type: | Disordered |
Name: | |
Location: | 35 - 39 |
Length: | 5 |
Region sequence: | VVETS |
Modification type: | Fragment Monomeric |
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | |
Functional subclasses: | Metal binding |
Detection methods:
| |
References:
| |
Comments: |
Region 2 | |
Type: | Disordered |
Name: | Long loop IV |
Location: | 89 - 125 |
Length: | 37 |
Region sequence: | EKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDL |
Modification type: | Fragment Monomeric |
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | |
Functional subclasses: | Metal binding |
Detection methods:
| |
References:
| |
Comments: |
Region 3 | |
Type: | Disordered |
Name: | Electrostatic loop VII |
Location: | 172 - 177 |
Length: | 6 |
Region sequence: | YLTNPS |
Modification type: | Fragment Monomeric |
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | |
Functional subclasses: | Metal binding |
Detection methods:
| |
References:
| |
Comments: |
Region 4 | |
Type: | Disordered |
Name: | |
Location: | 191 - 196 |
Length: | 6 |
Region sequence: | GNNEKQ |
Modification type: | Fragment Monomeric |
PDB: | |
Structural/functional type: | Function arises via a disorder to order transition |
Functional classes: | |
Functional subclasses: | Metal binding |
Detection methods:
| |
References:
| |
Comments: |
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
|