| General information | | DisProt: | DP00296 | | Name: | PemI-like protein 1 | | Synonym(s): | CHPR_ECO57
Protein mazE
| | First appeared in release: | Release 3.0 (02/17/2006) | | UniProt: | P0AE73 | | UniGene: | | | SwissProt: | CHPR_ECO57 | | TrEMBL: | | | NCBI (GI): | 83286876 | | Source organism: | Escherichia coli O157:H7 | | Sequence length: | 82 | | Percent disordered: | 50% | | Homologues: | |
| Native sequence |
10 20 30 40 50 60
| | | | | |
MIHSSVKRWG NSPAVRIPAT LMQALNLNID DEVKIDLVDG KLIIEPVRKE PVFTLAELVN - 60
DITPENLHEN IDWGEPKDKE VW
|
| Functional narrative |
May be involved in the regulation of cell growth. It acts as a suppressor of the inhibitory function of chpA protein. Both chpR and chpA bind to the promoter region of the chpRA operon to autoregulate their synthesis.
|
| Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
| Region 1 | | Type: | Disordered | | Name: | | | Location: | 1 - 3 | | Length: | 3 | | Region sequence: |
MIH | | Modification type: | Complex
| | PDB: | 1MVF:D, 1MVF:E | | Structural/functional type: | Relationship to function unknown
| | Functional classes: | Unknown
| | Functional subclasses: | Unknown
| Detection methods:
- X-ray crystallography (pH: 6.5; magnesium acetate 0.2 M; PBS; PEG 8000 20 %; protein (9 mg/ml); sodium cacodylate 0.1 M)
| References:
- Lah J, Simic M, Vesnaver G, Marianovsky I, Glaser G, Engelberg-Kulka H, Loris R. "Energetics of structural transitions of the addiction antitoxin MazE: is a programmed bacterial cell death dependent on the intrinsically flexible nature of the antitoxins?" J Biol Chem. 2005; 280(17): 17397-407. PubMed: 15735309
- Loris R, Marianovsky I, Lah J, Laeremans T, Engelberg-Kulka H, Glaser G, Muyldermans S, Wyns L. "Crystal structure of the intrinsically flexible addiction antidote MazE." J Biol Chem. 2003; 278(30): 28252-7. PubMed: 12743116
| Comments:This region is disordered while complexed with the protein fragment VHH.
|
| Region 2 | | Type: | Disordered | | Name: | | | Location: | 45 - 82 | | Length: | 38 | | Region sequence: |
EPVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW | | Modification type: | Complex
| | PDB: | 1MVF:D, 1MVF:E | | Structural/functional type: | Function arises via a disorder to molten globule transition
| | Functional classes: | Molecular assembly
| | Functional subclasses: | Apoptosis Regulation
Protein-protein binding
| Detection methods:
- X-ray crystallography (pH: 6.5; magnesium acetate 0.2 M; PBS; PEG 8000 20 %; protein (9 mg/ml); sodium cacodylate 0.1 M)
| References:
- Lah J, Simic M, Vesnaver G, Marianovsky I, Glaser G, Engelberg-Kulka H, Loris R. "Energetics of structural transitions of the addiction antitoxin MazE: is a programmed bacterial cell death dependent on the intrinsically flexible nature of the antitoxins?" J Biol Chem. 2005; 280(17): 17397-407. PubMed: 15735309
- Loris R, Marianovsky I, Lah J, Laeremans T, Engelberg-Kulka H, Glaser G, Muyldermans S, Wyns L. "Crystal structure of the intrinsically flexible addiction antidote MazE." J Biol Chem. 2003; 278(30): 28252-7. PubMed: 12743116
| Comments:The PDB files have this region starting at R48.
This region is disordered while complexed with the protein fragment VHH.
|
| Region 3 | | Type: | Disordered | | Name: | | | Location: | 77 - 82 | | Length: | 6 | | Region sequence: |
KDKEVW | | Modification type: | Complex
| | PDB: | 1UB4:C | | Structural/functional type: | Function arises via a disorder to molten globule transition
| | Functional classes: | Molecular assembly
| | Functional subclasses: | Apoptosis Regulation
Protein-protein binding
| Detection methods:
- X-ray crystallography (277 K; pH: 4.5; DTT 10 mM; glycerol (v/v) 15 %; NaAcetate 100 mM; NaCl 2 M; protein (40 mg/ml))
| References:
- Kamada K, Hanaoka F, Burley SK. "Crystal structure of the MazE/MazF complex: molecular bases of antidote-toxin recognition." Mol Cell. 2003; 11(4): 875-84. PubMed: 12718874
- Lah J, Simic M, Vesnaver G, Marianovsky I, Glaser G, Engelberg-Kulka H, Loris R. "Energetics of structural transitions of the addiction antitoxin MazE: is a programmed bacterial cell death dependent on the intrinsically flexible nature of the antitoxins?" J Biol Chem. 2005; 280(17): 17397-407. PubMed: 15735309
| Comments:This region is disordered while complexed with the protein MazF.
|
| If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|
