| General information | | DisProt: | DP00347 | | Name: | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma | | Synonym(s): | CNRG_BOVIN
GMP-PDE gamma
EC 3.1.4.17
PDE6
| | First appeared in release: | Release 3.0 (02/17/2006) | | UniProt: | P04972 | | UniGene: | Bt.54 | | SwissProt: | CNRG_BOVIN | | TrEMBL: | | | NCBI (GI): | 116582 | | Source organism: | Bos taurus (Bovine) | | Sequence length: | 87 | | Percent disordered: | 100% | | Homologues: | |
| Native sequence |
10 20 30 40 50 60
| | | | | |
MNLEPPKAEI RSATRVMGGP VTPRKGPPKF KQRQTRQFKS KPPKKGVQGF GDDIPGMEGL - 60
GTDITVICPW EAFNHLELHE LAQYGII
|
| Functional narrative |
Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.
|
| Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
| Region 1 | | Type: | Disordered | | Name: | | | Location: | 1 - 87 | | Length: | 87 | | Region sequence: |
MNLEPPKAEIRSATRVMGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGL
GTDITVICPWEAFNHLELHELAQYGII | | Modification type: | Native
| | PDB: | | | Structural/functional type: | Function arises from the disordered state
| | Functional classes: | Unknown
| | Functional subclasses: | Substrate/ligand binding
| Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (277 K; pH: 8; HEPES 10 mM; protein 10 uM; Zn2+)
- Circular dichroism (CD) spectroscopy, near-UV (310 K; pH: 8; HEPES 10 mM; protein 10 uM; Zn2+)
- Fluorescence, intrinsic (277 K; pH: 8; protein 1.14 uM; Zn2+)
- Size exclusion/gel filtration chromatography (288 K; urea 8 M)
- Fluorescence, intrinsic (293 K; pH: 8; HEPES 10 mM; protein 1.14 uM)
| References:
- Uversky VN, Permyakov SE, Zagranichny VE, Rodionov IL, Fink AL, Cherskaya AM, Wasserman LA, Permyakov EA. "Effect of zinc and temperature on the conformation of the gamma subunit of retinal phosphodiesterase: a natively unfolded protein." J Proteome Res. 2002; 1(2): 149-59. PubMed: 12643535
| Comments:
|
| References |
- Ovchinnikov Yu A, Lipkin VM, Kumarev VP, Gubanov VV, Khramtsov NV, Akhmedov NB, Zagranichny VE, Muradov KG. "Cyclic GMP phosphodiesterase from cattle retina. Amino acid sequence of the gamma-subunit and nucleotide sequence of the corresponding cDNA." FEBS Lett. 1986; 204(2): 288-92. PubMed: 3015681
|
| If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|
