| General information | | DisProt: | DP00510 | | Name: | Nuclear protein 1 | | Synonym(s): | NUPR1_HUMAN
Protein p8
Candidate of metastasis 1
| | First appeared in release: | Release 3.2 (05/26/2006) | | UniProt: | O60356 | | UniGene: | Hs.513463 | | SwissProt: | NUPR1_HUMAN | | TrEMBL: | | | NCBI (GI): | 6226951 | | Source organism: | Homo sapiens (Human) | | Sequence length: | 82 | | Percent disordered: | 100% | | Homologues: | |
| Native sequence |
10 20 30 40 50 60
| | | | | |
MATFPPATSA PQQPPGPEDE DSSLDESDLY SLAHSYLGGG GRKGRTKREA AANTNRPSPG - 60
GHERKLVTKL QNSERKKRGA RR
|
| Functional narrative |
Could participate in the response to proapoptotic stimuli and promotes cellular growth in a way that helps the tissue counteract diverse injuries. May contribute to the metastatic phenotype.
|
| Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
| Region 1 | | Type: | Disordered | | Name: | | | Location: | 1 - 82 | | Length: | 82 | | Region sequence: |
MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPG
GHERKLVTKLQNSERKKRGARR | | Modification type: | Engineered
Monomeric
| | PDB: | | | Structural/functional type: | Function arises via a disorder to order transition
| | Functional classes: | Modification site
Molecular recognition effectors
| | Functional subclasses: | Nuclear localization
Phosphorylation
Protein-DNA binding
| Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (pH: 6; NaCl 2 mM; Phosphate 20 mM)
- Circular dichroism (CD) spectroscopy, near-UV (pH: 6; NaCl 2 mM; Phosphate 20 mM)
- Nuclear magnetic resonance (NMR)
- Fourier transform infrared spectroscopy (FTIR), aka infrared spectroscopy) (CAPS 10 mM; EDTA 0.1 mM; MOPS 10 mM; NaCl 100 mM; sodium acetate (buffer) 10 mM)
| References:
- Encinar JA, Mallo GV, Mizyrycki C, Giono L, Gonzalez-Ros JM, Rico M, Canepa E, Moreno S, Neira JL, Iovanna JL. "Human p8 is a HMG-I/Y-like protein with DNA binding activity enhanced by phosphorylation." J Biol Chem. 2001; 276(4): 2742-51. PubMed: 11056169
| Comments:
|
| References |
- Vasseur S, Vidal Mallo G, Fiedler F, Bodeker H, Canepa E, Moreno S, Iovanna JL. "Cloning and expression of the human p8, a nuclear protein with mitogenic activity." Eur J Biochem. 1999; 259(3): 670-5. PubMed: 10092851
|
| If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|
