DP00573_C005: Protein VP3 [cleavage product 5]FASTA viewXML view

General information
DisProt:DP00573_C005
Name:Protein VP3 [cleavage product 5]
Synonym(s):POLG_FMDVO
P1C
Virion protein 3
cleavage product 5 of Genome polyprotein
First appeared in release:Release 5.4 (10/14/2010)
UniProt:P03305
UniGene: 
SwissProt: POLG_FMDVO
TrEMBL:  
NCBI (GI):  
Source organism:Foot-and-mouth disease virus
Sequence length:220
Percent disordered:19%
Homologues: 


Native sequence

        10         20         30         40         50         60
         |          |          |          |          |          |
GIFPVACSDG YGGLVTTDPK TADPVYGKVF NPPRNQLPGR FTNLLDVAEA CPTFLRFEGG - 60
VPYVTTKTDS DRVLAQFDMS LAAKQMSNTF LAGLAQYYTQ YSGTINLHFM FTGPTDAKAR - 120
YMVAYAPPGM EPPKTPEAAA HCIHAEWDTG LNSKFTFSIP YLSAADYAYT ASGVAETTNV - 180
QGWVCLFQIT HGKADGDALV VLASAGKDFE LRLPVDARAE



Functional narrative    

Capsid proteins VP1, VP2, VP3 and VP4 form a closed capsid enclosing the viral positive strand RNA genome. VP4 lies on the inner surface of the protein shell formed by VP1, VP2 and VP3. All the three latter proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approximately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes. (UniProt) Virion protein 3 is cleavage product 5 of Genome polyprotein [Isoform Lab], comprising aa 505-724 of the polyprotein.

Region 1: 1-42

Map of ordered and disordered regions







Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.


Region 1
Type:Disordered - Extended
Name:N-terminal region
Location:1 - 42
Length:42
Region sequence:

GIFPVACSDGYGGLVTTDPKTADPVYGKVFNPPRNQLPGRFT

Modification type: Native
PDB:  
Structural/functional type: Relationship to function unknown
Functional classes: Unknown
Functional subclasses: Unknown
Detection methods:
  1. X-ray crystallography

References:
  1. Acharya R, Fry E, Stuart D, Fox G, Rowlands D, Brown F. "The three-dimensional structure of foot-and-mouth disease virus at 2.9 A resolution." Nature. 1989; 337(6209): 709-16. PubMed: 2537470

Comments:
 



References

  1. Acharya R, Fry E, Stuart D, Fox G, Rowlands D, Brown F. "The three-dimensional structure of foot-and-mouth disease virus at 2.9 A resolution." Nature. 1989; 337(6209): 709-16. PubMed: 2537470

  2. Cheung A, DeLamarter J, Weiss S, K├╝pper H. "Comparison of the major antigenic determinants of different serotypes of foot-and-mouth disease virus." J Virol. 1983; 48(2): 451-9. PubMed: 6194313



Comments


Previous entry DP00573 has been split into polyprotein (DP00573) and cleavage products (DP00573_C0XX).


If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us.


Disprot-footer
Contact us