Annotation for this protein is in progress - please check future releases for more complete information



DP00584: Protein starmakerFASTA viewXML view

General information
DisProt:DP00584
Name:Protein starmaker
Synonym(s):STM_DANRE
First appeared in release:Release 4.7 (10/08/2008)
UniProt:A2VD23
UniGene:Dr.79127
SwissProt: STM_DANRE
TrEMBL:  
NCBI (GI): 166223487
Source organism:Danio rerio (Zebrafish)(Brachydanio rerio)
Sequence length:613
Percent disordered:100%
Homologues: 


Native sequence

        10         20         30         40         50         60
         |          |          |          |          |          |
MLSRTVFVPL ILAFVGVSIS APVSNNNGTD NDESAADQRH IFTVQFNVGT PAPADGDSVT - 60
TDGKDSAEKN EAPGDSSDTT EKPGTTDGKD SAEQHGVTTD GKDEAEQHGV TTDGQDSAEK - 120
RGEADGAPDK PDTQNGTDDT DSDQETDASH HKTGDSDENK DKPSAEDHTD GNHAGKDSTD - 180
SKESPDTTDK PEGPDSDSAP DGDSASAEKT DSDHSPDEDA NKSSTEADKD DTSDKDSSQT - 240
DEKHDSDASD KDEKHEDKDE KSDEKDSSKD SEDKSQEKSD KSDDGSNSEA DEQKESVESK - 300
DHDSDSQDSD SAEKKEKHDD KDQDSSDSAD SKDSDEDKDK DHSEQKDSED HEHKEKHTKD - 360
KEEHKDSDEG KDDEDKSKSD EHDKDESESK EASKSDESEQ EEKKDDKSDS DNSSRDSHSD - 420
SDSDSHSDSD SDSHSDSHSD SDSDSHSDSD SDSDSDSDSD SDSDSDSNSR DKDEKKDKSS - 480
ESRDEDSSDS DSKSNSESSE TAEEDTNDDK DSSVEKDKTD SSDSASVEAN DSDDEHDDDS - 540
KDATPSSEDH TAEKTDEDSH DVSDDDDDID AHDDEAGVEH GTDEASKPHQ EPDHHDDTTH - 600
GSDDGRKTSM PIS



Functional narrative    

Essential for the formation of otoliths in the inner ear of developing larvae and for the perception of gravity and acceleration. May be one of the organic components of the ortholiths.

Region 1: 1-613

Map of ordered and disordered regions







Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.


Region 1
Type:Disordered
Name: 
Location:1 - 613
Length:613
Region sequence:

MLSRTVFVPLILAFVGVSISAPVSNNNGTDNDESAADQRHIFTVQFNVGTPAPADGDSVT
TDGKDSAEKNEAPGDSSDTTEKPGTTDGKDSAEQHGVTTDGKDEAEQHGVTTDGQDSAEK
RGEADGAPDKPDTQNGTDDTDSDQETDASHHKTGDSDENKDKPSAEDHTDGNHAGKDSTD
SKESPDTTDKPEGPDSDSAPDGDSASAEKTDSDHSPDEDANKSSTEADKDDTSDKDSSQT
DEKHDSDASDKDEKHEDKDEKSDEKDSSKDSEDKSQEKSDKSDDGSNSEADEQKESVESK
DHDSDSQDSDSAEKKEKHDDKDQDSSDSADSKDSDEDKDKDHSEQKDSEDHEHKEKHTKD
KEEHKDSDEGKDDEDKSKSDEHDKDESESKEASKSDESEQEEKKDDKSDSDNSSRDSHSD
SDSDSHSDSDSDSHSDSHSDSDSDSHSDSDSDSDSDSDSDSDSDSDSNSRDKDEKKDKSS
ESRDEDSSDSDSKSNSESSETAEEDTNDDKDSSVEKDKTDSSDSASVEANDSDDEHDDDS
KDATPSSEDHTAEKTDEDSHDVSDDDDDIDAHDDEAGVEHGTDEASKPHQEPDHHDDTTH
GSDDGRKTSMPIS

Modification type: Native
PDB:  
Structural/functional type: Function arises via a disorder to order transition
Functional classes: Molecular assembly
Functional subclasses: Phosphorylation
Substrate/ligand binding
Protein-protein binding
Detection methods:
  1. SDS-PAGE gel, Aberrant mobility on

  2. Circular dichroism (CD) spectroscopy, far-UV

  3. Fluorescence polarization/anisotropy

References:
There are no documents referencing this region.
Comments:
 



References

  1. Kapłon TM, Rymarczyk G, Nocula-Ługowska M, Jak√≥b M, Kochman M, Lisowski M, Szewczuk Z, Ozyhar A. "Starmaker exhibits properties of an intrinsically disordered protein." Biomacromolecules. 2008; 9(8): 2118-25. PubMed: 18636772


If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us.


Disprot-footer
Contact us