| General information | | DisProt: | DP00592 | | Name: | Purkinje cell protein 4 | | Synonym(s): | PCP4_HUMAN
Brain-specific antigen PCP-4
Brain-specific polypeptide PEP-19
| | First appeared in release: | Release 4.9 (01/06/2009) | | UniProt: | P48539 | | UniGene: | Hs.80296 | | SwissProt: | PCP4_HUMAN | | TrEMBL: | | | NCBI (GI): | 3915800 | | Source organism: | Homo sapiens (Human) | | Sequence length: | 62 | | Percent disordered: | 100% | | Homologues: | |
| Native sequence |
10 20 30 40 50 60
| | | | | |
MSERQGAGAT NGKDKTSGEN DGQKKVQEEF DIDMDAPETE RAAVAIQSQF RKFQKKKAGS - 60
QS
|
| Functional narrative |
PEP-19 is a small IQ-motif CaM binding protein originally identified in the central nervous system. It is present at high concentrations (up to 40-50 micromolar), but have no known activity other than binding to calmodulin (CaM) in the presence or absence of Ca2+. PEP-19 have unique effect on Ca2+ binding to the C-domain of CaM. The expression of PEP-19 is not restricted to the central nervous system, and its pattern of expression suggests a link to Ca2+ metabolism. It has a protective role against the high Ca2+ concentration in normal or pathogenic conditions.
|
| Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
| Region 1 | | Type: | Disordered | | Name: | | | Location: | 1 - 62 | | Length: | 62 | | Region sequence: |
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGS
QS | | Modification type: | Native
| | PDB: | | | Structural/functional type: | | | Functional classes: | | | Functional subclasses: | Protein-protein binding
| Detection methods:
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 6.3; EGTA or CaCl2 1 mM; KCl 100 mM; MES (buffer) 10 mM; PEP-19 20 microM)
- Nuclear magnetic resonance (NMR) (298 K; pH: 6.3; D2O 5 %; EGTA 1 mM; Imidazole 10 mM; KCl 100 mM; PEP-19 0.5 mM)
| References:
- Kleerekoper QK, Putkey JA. "PEP-19: An intrinsically disordered regulator of calmodulin signaling." J Biol Chem. 2008. PubMed: 19106096
| Comments:
|
| If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|
