General information | DisProt: | DP00626_C001 | Name: | Protein umuD' [cleavage product 1] | Synonym(s): | UMUD_ECOLI
| First appeared in release: | Release 5.2 (08/07/2010) | UniProt: | P0AG11 | UniGene: | | SwissProt: | UMUD_ECOLI | TrEMBL: | | NCBI (GI): | | Source organism: | Escherichia coli (strain K12) | Sequence length: | 115 | Percent disordered: | 100% | Homologues: | |
Native sequence |
10 20 30 40 50 60 | | | | | | GFPSPAADYV EQRIDLNQLL IQHPSATYFV KASGDSMIDG GISDGDLLIV DSAITASHGD - 60 IVIAAVDGEF TVKKLQLRPT VQLIPMNSAY SPITISSEDT LDVFGVVIHV VKAMR
|
Functional narrative |
Involved in UV protection and mutation. Essential for induced (or SOS) mutagenesis. May modify the DNA replication machinery to allow bypass synthesis across a damaged template. Protein umuD' is cleavage product 1 of protein umuD, comprising aa 25-139 of the polyprotein.
|
Map of ordered and disordered regions |
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
Region 1 | Type: | Disordered - Extended | Name: | N-terminal domain | Location: | 1 - 7 | Length: | 7 | Region sequence: |
GFPSPAA | Modification type: | Native
| PDB: | 1AY9:A, 1I4V:A, 1UMU:A | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Entropic chain
Modification site
Molecular recognition effectors
| Functional subclasses: | Protein-DNA binding
Entropic clock
Protein-protein binding
| Detection methods:
- Sensitivity to proteolysis (310 K; UmuD'(2) dimer 10 uM; Chymotrypsin (1:1) 5 mg/mL)
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 6.8; DTT (buffer) 1 mM; EDTA (buffer) 0.1 mM; Na3PO4 (buffer (pH 6.8)) 10 mM; NaCl (buffer) 100 mM; UmuD' (at physio concentrations or w/interacting protein at >/= 50uM))
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 7.4; Glycerol (buffer (5%)); Hepes (buffer (7.4 pH)) 50 mM; KCl (buffer) 100 mM; MgCl2 (buffer) 5 mM; UmuD' (at physio concentrations or w/interacting protein at >/= 50uM))
| References:
- Simon SM, Sousa FJ, Mohana-Borges R, Walker GC. "Regulation of Escherichia coli SOS mutagenesis by dimeric intrinsically disordered umuD gene products." Proc Natl Acad Sci U S A. 2008; 105(4): 1152-7. PubMed: 18216271
| Comments:
|
Region 2 | Type: | Disordered - Molten Globule | Name: | | Location: | 8 - 115 | Length: | 108 | Region sequence: |
DYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVD GEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR | Modification type: | Native
| PDB: | 1AY9:A, 1I4V:A, 1UMU:A | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Modification site
Molecular recognition effectors
Entropic chain
| Functional subclasses: | Protein-DNA binding
Protein-protein binding
Entropic clock
| Detection methods:
- Sensitivity to proteolysis (310 K; Chymotrypsin (1:1) 5 mg/mL; UmuD'(2) dimer 10 uM)
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 6.8; DTT (buffer) 1 mM; EDTA (buffer) 0.1 mM; Na3PO4 (buffer (pH 6.8)) 10 mM; NaCl (buffer) 100 mM; UmuD' (at physio concentrations or w/interacting protein at >/= 50uM))
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 7.4; Glycerol (buffer (5%)); Hepes (buffer (7.4 pH)) 50 mM; KCl (buffer) 100 mM; MgCl2 (buffer) 5 mM; UmuD' (at physio concentrations or w/interacting protein at >/= 50uM))
| References:
- Simon SM, Sousa FJ, Mohana-Borges R, Walker GC. "Regulation of Escherichia coli SOS mutagenesis by dimeric intrinsically disordered umuD gene products." Proc Natl Acad Sci U S A. 2008; 105(4): 1152-7. PubMed: 18216271
| Comments:
|
References |
- Ferentz AE, Walker GC, Wagner G. "Converting a DNA damage checkpoint effector (UmuD2C) into a lesion bypass polymerase (UmuD'2C)." EMBO J.. 2001; 20(15): 4287-98. PubMed: 11483531
- Peat TS, Frank EG, McDonald JP, Levine AS, Woodgate R, Hendrickson WA. "Structure of the UmuD' protein and its regulation in response to DNA damage." Nature. 1996; 380(6576): 727-30. PubMed: 8614470
- Peat TS, Frank EG, McDonald JP, Levine AS, Woodgate R, Hendrickson WA. "The UmuD' protein filament and its potential role in damage induced mutagenesis." Structure. 1996; 4(12): 1401-12. PubMed: 8994967
- Simon SM, Sousa FJ, Mohana-Borges R, Walker GC. "Regulation of Escherichia coli SOS mutagenesis by dimeric intrinsically disordered umuD gene products." Proc Natl Acad Sci U S A. 2008; 105(4): 1152-7. PubMed: 18216271
|
Comments |
UmuD' operates in homodimeric form.
AV (7-7-2010) PubMed: 18216271
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|