General information | DisProt: | DP00661 | Name: | Protein LBH | Synonym(s): | LBH_MOUSE
Limb bud and heart-expressed protein
| First appeared in release: | Release 5.1 (05/28/2010) | UniProt: | Q9CX60 | UniGene: | Mm.478306 | SwissProt: | LBH_MOUSE | TrEMBL: | | NCBI (GI): | 81880977 | Source organism: | Mus musculus (Mouse) | Sequence length: | 105 | Percent disordered: | 67% | Homologues: | |
Native sequence |
10 20 30 40 50 60 | | | | | | MSVYFPIHCS DYLRSAEMTE VMMNAPSMEE IGLSPRKDGL SYQIFPDPSD FDRCCKLKDR - 60 LPSIVVEPTE GEVESGELRW PPEEFLVQED EQDNCEETTN EKKDQ
|
Functional narrative |
Modulates the activity of key transcription factors involved in cardiogenesis.
|
Map of ordered and disordered regions |
![](regions/DP00661.gif)
![](regions/legend.gif)
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
Region 1 | Type: | Disordered | Name: | | Location: | 15 - 38 | Length: | 24 | Region sequence: |
SAEMTEVMMNAPSMEEIGLSPRKD | Modification type: | Monomeric
Native
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular recognition effectors
| Functional subclasses: | Transactivation (transcriptional activation)
| Detection methods:
- Size exclusion/gel filtration chromatography (277 K; pH: 8; LBH (purified to ~20-30 mg/L) 20 mg/L; Tris 50 mM; NaCl 200 mM; beta-mercaptoehtanol 5 mM; EDTA 1 mM)
- Static light scattering (277 K; pH: 8; beta-mercaptoehtanol 5 mM; EDTA 1 mM; LBH (purified to ~20-30 mg/L) 20 mg/L; NaCl 200 mM; Tris 50 mM)
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 8; LBH 10 uM; sodium phosphate 50 mM)
- Circular dichroism (CD) spectroscopy, near-UV (298 K; pH: 8; LBH 10 uM; sodium phosphate 50 mM)
- Fluorescence, intrinsic (298 K; pH: 6.5; beta-mercaptoehtanol 0.1 mM; LBH 10 uM; NaCl (50 or 250 mM); phosphate 50 mM)
- Nuclear magnetic resonance (NMR) (298 K; pH: 6.5; D2O 5 %; LBH (15N-isotopic labelled) 0.5 mM; NaCl 250 mM; phosphate 50 mM)
| References:
- Al-Ali H, Rieger ME, Seldeen KL, Harris TK, Farooq A, Briegel KJ. "Biophysical characterization reveals structural disorder in the developmental transcriptional regulator LBH." Biochem Biophys Res Commun. 2010; 391(1): 1104-9. PubMed: 20005203
| Comments:
|
Region 2 | Type: | Disordered | Name: | | Location: | 60 - 105 | Length: | 46 | Region sequence: |
RLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTNEKKDQ | Modification type: | Monomeric
Native
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular recognition effectors
| Functional subclasses: | Transactivation (transcriptional activation)
| Detection methods:
- Size exclusion/gel filtration chromatography (277 K; pH: 8; LBH (purified to ~20-30 mg/L) 20 mg/L; Tris 50 mM; NaCl 200 mM; beta-mercaptoehtanol 5 mM; EDTA 1 mM)
- Static light scattering (277 K; pH: 8; beta-mercaptoehtanol 5 mM; EDTA 1 mM; LBH (purified to ~20-30 mg/L) 20 mg/L; NaCl 200 mM; Tris 50 mM)
- Circular dichroism (CD) spectroscopy, far-UV (298 K; pH: 8; LBH 10 uM; sodium phosphate 50 mM)
- Circular dichroism (CD) spectroscopy, near-UV (298 K; pH: 8; LBH 10 uM; sodium phosphate 50 mM)
- Fluorescence, intrinsic (298 K; pH: 6.5; beta-mercaptoehtanol 0.1 mM; LBH 10 uM; NaCl (50 or 250 mM); phosphate 50 mM)
- Nuclear magnetic resonance (NMR) (298 K; pH: 6.5; D2O 5 %; LBH (15N-isotopic labelled) 0.5 mM; NaCl 250 mM; phosphate 50 mM)
| References:
- Al-Ali H, Rieger ME, Seldeen KL, Harris TK, Farooq A, Briegel KJ. "Biophysical characterization reveals structural disorder in the developmental transcriptional regulator LBH." Biochem Biophys Res Commun. 2010; 391(1): 1104-9. PubMed: 20005203
| Comments:
|
References |
- Al-Ali H, Rieger ME, Seldeen KL, Harris TK, Farooq A, Briegel KJ. "Biophysical characterization reveals structural disorder in the developmental transcriptional regulator LBH." Biochem Biophys Res Commun. 2010; 391(1): 1104-9. PubMed: 20005203
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|