General information | DisProt: | DP00693 | Name: | Amelogenin | Synonym(s): | AMEL_PIG
Amelogenin 173A
| First appeared in release: | Release 5.5 (11/17/2010) | UniProt: | P45561 | UniGene: | | SwissProt: | AMEL_PIG | TrEMBL: | | NCBI (GI): | | Source organism: | Sus scrofa (Pig) | Sequence length: | 173 | Percent disordered: | 99% | Homologues: | |
Native sequence |
10 20 30 40 50 60 | | | | | | MPLPPHPGHP GYINFSYEVL TPLKWYQNMI RHPYTSYGYE PMGGWLHHQI IPVVSQQTPQ - 60 SHALQPHHHI PMVPAQQPGI PQQPMMPLPG QHSMTPTQHH QPNLPLPAQQ PFQPQPVQPQ - 120 PHQPLQPQSP MHPIQPLLPQ PPLPPMFSMQ SLLPDLPLEA WPATDKTKRE EVD
|
Functional narrative |
Plays a role in the biomineralization of teeth. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel. A number of other isoforms are produced by carboxy-terminal processing. Belongs to the amelogenin family. (UniProt) DP00693 is the mature form of amelogenin, with signal peptide removed (aa 1-16 in UniProt record).
|
Map of ordered and disordered regions |
![](regions/DP00693.gif)
![](regions/legend.gif)
Note: 'Mouse' over a region to see the start and stop residues. Click on a region to see detailed information.
|
Region 1 | Type: | Disordered w/ Residual Structure | Name: | extended beta-strand | Location: | 2 - 22 | Length: | 21 | Region sequence: |
PLPPHPGHPGYINFSYEVLTP | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3.8; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 2 | Type: | Disordered w/ Residual Structure | Name: | alpha-helix | Location: | 23 - 27 | Length: | 5 | Region sequence: |
LKWYQ | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3.8; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 3 | Type: | Disordered - Extended | Name: | random coil | Location: | 28 - 36 | Length: | 9 | Region sequence: |
NMIRHPYTS | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises from the disordered state | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3.8; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 4 | Type: | Disordered w/ Residual Structure | Name: | beta-turn | Location: | 37 - 45 | Length: | 9 | Region sequence: |
YGYEPMGGW | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 5 | Type: | Disordered w/ Residual Structure | Name: | extended beta-strand | Location: | 46 - 62 | Length: | 17 | Region sequence: |
LHHQIIPVVSQQTPQSH | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 6 | Type: | Disordered | Name: | random coil | Location: | 63 - 69 | Length: | 7 | Region sequence: |
ALQPHHH | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises from the disordered state | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 7 | Type: | Disordered w/ Residual Structure | Name: | PPII helix | Location: | 70 - 89 | Length: | 20 | Region sequence: |
IPMVPAQQPGIPQQPMMPLP | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 8 | Type: | Disordered w/ Residual Structure | Name: | extended beta-strand | Location: | 90 - 101 | Length: | 12 | Region sequence: |
GQHSMTPTQHHQ | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 9 | Type: | Disordered w/ Residual Structure | Name: | PPII helix | Location: | 102 - 145 | Length: | 44 | Region sequence: |
PNLPLPAQQPFQPQPVQPQPHQPLQPQSPMHPIQPLLPQPPLPP | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises via a disorder to order transition | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-protein binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
Region 10 | Type: | Disordered - Pre-Molten Globule | Name: | random coil | Location: | 146 - 173 | Length: | 28 | Region sequence: |
MFSMQSLLPDLPLEAWPATDKTKREEVD | Modification type: | Engineered
Monomeric
| PDB: | | Structural/functional type: | Function arises from the disordered state | Functional classes: | Molecular assembly
| Functional subclasses: | Protein-Biocrystal binding
| Detection methods:
- Dynamic light scattering (283 K; pH: 6; rP172 Amelogenin 75 uM; unbuffered double-distiilled water)
- Circular dichroism (CD) spectroscopy, far-UV (283 K; )
- Nuclear magnetic resonance (NMR) (283 K; pH: 3; D2O (10% v/v); Milli-Q pure deionized distilled water; rP172 Amelogenin 75 uM)
| References:
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
| Comments:According to Delak et al (2009), amelogenin is divided into three domains: the extended N-terminal TRAP domain (aa 1-45), a central domain (aa 46-156) and the pre-molten globule C-terminal domain (aa 157-173).
|
References |
- Delak K, Harcup C, Lakshminarayanan R, Sun Z, Fan Y, Moradian-Oldak J, Evans JS. "The tooth enamel protein, porcine amelogenin, is an intrinsically disordered protein with an extended molecular configuration in the monomeric form." Biochemistry. 2009; 48(10): 2272-81. PubMed: 19236004
- Lakshminarayanan R, Fan D, Du C, Moradian-Oldak J. "The role of secondary structure in the entropically driven amelogenin self-assembly." Biophys J. 2007; 93(10): 3664-74. PubMed: 17704165
- Moradian-Oldak J and Lakshminarayanan L. (Bentham Science Publishers, Ltd, e-book). "Intrinsic disorder in amelogenins." Amelogenins: Multifaceted Proteins For Dental And Bone Formation And Repair. 2010; 106-132.
|
Comments |
Experiments by Delak et al (2009) were performed on recombinant porcine amelogenin rP172.
AV 11/03/2010 (PubMed: 19236004)
|
If you have any comments or wish to provide additional references to this protein or its disordered region(s), please click here to e-mail us. |
Disprot-footer
|